PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G076500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 294aa    MW: 32470.4 Da    PI: 9.3471
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G076500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.49e-103074447
                          S-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding  4 WTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqky 47
                          WT+eE +++  a + l     +W+++a+ ++ gRt  +++s++ ++
  Sobic.003G076500.1.p 30 WTAEENKRFESALAGLDLChpDWEKVAQAIP-GRTVREVVSHFKNL 74
                          ****************99999**********.***********997 PP

2Myb_DNA-binding48.12.6e-15141185347
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           +WT+eE++l++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
  Sobic.003G076500.1.p 141 PWTEEEHKLFLLGLKKYGKGDWRNISRNFVQTRTPTQVASHAQKY 185
                           8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.7152579IPR017884SANT domain
SMARTSM007176.6E-42677IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-42874IPR009057Homeodomain-like
SuperFamilySSF466891.15E-82979IPR009057Homeodomain-like
CDDcd001672.49E-73074No hitNo description
PfamPF002492.8E-73074IPR001005SANT/Myb domain
PROSITE profilePS5129418.359134190IPR017930Myb domain
SuperFamilySSF466896.21E-18135190IPR009057Homeodomain-like
TIGRFAMsTIGR015575.7E-17137188IPR006447Myb domain, plants
SMARTSM007173.4E-13138188IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-12138184IPR009057Homeodomain-like
CDDcd001677.56E-12141186No hitNo description
PfamPF002499.8E-13141185IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MMREMYMDVL PPVDHIAARS NWFPAAARLW TAEENKRFES ALAGLDLCHP DWEKVAQAIP  60
GRTVREVVSH FKNLQLDVQQ IESGQVPLPV YGSGASSFTL QWDGNGGYGP GDFRHGYRFG  120
GGCGKRHHGR TPEQERKKGV PWTEEEHKLF LLGLKKYGKG DWRNISRNFV QTRTPTQVAS  180
HAQKYFIRLN SGGKDKRRSS IHDITTVNLT DEQPPSPSQS SLITNQSNAS APTAGIGQFS  240
LAADAKQHGS GNLPFNSPSR TSVMAAYRMD LQDQGLQCGP LHDQLVASQS ILF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.77380.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9568590.0EU956859.1 Zea mays clone 1575939 MYB-like transcription factor DIVARICATA mRNA, complete cds.
GenBankEU9699530.0EU969953.1 Zea mays clone 337779 MYB-like transcription factor DIVARICATA mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001130679.10.0putative MYB DNA-binding domain superfamily protein
RefseqXP_008654259.10.0PREDICTED: putative MYB DNA-binding domain superfamily protein isoform 1 isoform X1
RefseqXP_008654260.10.0PREDICTED: putative MYB DNA-binding domain superfamily protein isoform 1 isoform X1
SwissprotQ8S9H72e-80DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLB6SVU40.0B6SVU4_MAIZE; MYB-like transcription factor DIVARICATA
STRINGGRMZM2G079458_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.14e-67MYB family protein